Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Sodium channel regulatory subunit beta-1 (SCN1B), partial

This Recombinant Human Sodium channel regulatory subunit beta-1 (SCN1B), partial spans the amino acid sequence from region 19-157. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Sodium channel regulatory subunit beta-1 SCN1B

UniProt

Q07699

Expression Region

19-157

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GGCVEVDSETEAVYGMTFKILCISCKRRSETNAETFTEWTFRQKGTEEFVKILRYENEVLQLEEDERFEGRVVWNGSRGTKDLQDLSIFITNVTYNHSGDYECHVYRLLFFENYEHNTSVVKKIHIEVVDKANRDMASI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat soluble Interleukin 18 Receptor (sIL-18R) ELISA Kit
EIA05900r 1 Kit

Rat soluble Interleukin 18 Receptor (sIL-18R) ELISA Kit

Sign In for Pricing
View Details
Lentiviral mouse Cage1 shRNA (UAS) - Lentiviral mouseCage1 shRNA (UAS, GFP) (25)
GTR15204800 1 Vial

Lentiviral mouse Cage1 shRNA (UAS) - Lentiviral mouseCage1 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
Uspl1 3'UTR Lenti-reporter-Luc Vector
49383086 1.0 µg

Uspl1 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
AAAS (Aladin, Adracalin, ADRACALA, GL003) (Biotin)
122774-Biotin 100 µL

AAAS (Aladin, Adracalin, ADRACALA, GL003) (Biotin)

Sign In for Pricing
View Details
OAAV00379-200UG - TAU Antibody
OAAV00379-200UG 200µg

OAAV00379-200UG - TAU Antibody

Sign In for Pricing
View Details
OATP2 (SLCO1B1) Human shRNA Plasmid Kit (Locus ID 10599)
TR309267 1 Kit

OATP2 (SLCO1B1) Human shRNA Plasmid Kit (Locus ID 10599)

Sign In for Pricing
View Details