Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Son of sevenless homolog 2 (SOS2), partial

This Recombinant Human Son of sevenless homolog 2 (SOS2), partial spans the amino acid sequence from region 778-1017. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Son of sevenless homolog 2; SOS-2; SOS2

UniProt

Q07890

Expression Region

778-1017

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

HPIEIARQLTLLESDLYRKVQPSELVGSVWTKEDKEINSPNLLKMIRHTTNLTLWFEKCIVEAENFEERVAVLSRIIEILQVFQDLNNFNGVLEIVSAVNSVSVYRLDHTFEALQERKRKILDEAVELSQDHFKKYLVKLKSINPPCVPFFGIYLTNILKTEEGNNDFLKKKGKDLINFSKRRKVAEITGEIQQYQNQPYCLRIEPDMRRFFENLNPMGSASEKEFTDYLFNKSLEIEPR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Interleukin 18 (IL18) Antibody Pair Kit (with Standard)
MBS2098352-01 5x 96 Tests

Rabbit Interleukin 18 (IL18) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Rabbit Interleukin 18 (IL18) Antibody Pair Kit (with Standard)
MBS2098352-02 5x 96 Tests + MBS2090685 (Ab Pairs Support Pack 1,5x 96 Tests)

Rabbit Interleukin 18 (IL18) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Rabbit Interleukin 18 (IL18) Antibody Pair Kit (with Standard)
MBS2098352-03 10x 96 Tests

Rabbit Interleukin 18 (IL18) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Rabbit Interleukin 18 (IL18) Antibody Pair Kit (with Standard)
MBS2098352-04 10x 96 Tests + MBS2090685 (Ab Pairs Support Pack 1, 10x 96 Tests)

Rabbit Interleukin 18 (IL18) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Rat growth differentiation factor 15, GDF15 ELISA Kit
CK-bio-14739-01 48 Tests

Rat growth differentiation factor 15, GDF15 ELISA Kit

Sign In for Pricing
View Details
Rat growth differentiation factor 15, GDF15 ELISA Kit
CK-bio-14739-02 96 Tests

Rat growth differentiation factor 15, GDF15 ELISA Kit

Sign In for Pricing
View Details