Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Alpha-actinin-3 (ACTN3), partial

This Recombinant Human Alpha-actinin-3 (ACTN3), partial spans the amino acid sequence from region 158-264. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Alpha-actinin-3; Alpha-actinin skeletal muscle isoform 3; F-actin cross-linking protein; ACTN3

UniProt

Q08043

Expression Region

158-264

Origin

Homo sapiens (Human)

Field of Research

Musculoskeletal & Connective Tissue Research

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

TSAKEGLLLWCQRKTAPYRNVNVQNFHTSWKDGLALCALIHRHRPDLIDYAKLRKDDPIGNLNTAFEVAEKYLDIPKMLDAEDIVNTPKPDEKAIMTYVSCFYHAFA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

COPS3 Antibody
A76476-100UL 100 µL

COPS3 Antibody

Sign In for Pricing
View Details
DUSP15, CT (Dual-specificity Protein Phosphatase 15, Vaccinia Virus VH1-Related Dual-specific Protein Phosphatase Y, VH1-related Member Y, C20orf57, VHY) (MaxLight 405) discontinued
D9840-49-ML405 100 µL

DUSP15, CT (Dual-specificity Protein Phosphatase 15, Vaccinia Virus VH1-Related Dual-specific Protein Phosphatase Y, VH1-related Member Y, C20orf57, VHY) (MaxLight 405) discontinued

Sign In for Pricing
View Details
FLT4 peptide
orb382326-01 1 mg

FLT4 peptide

Sign In for Pricing
View Details
FLT4 peptide
orb382326-02 5 mg

FLT4 peptide

Sign In for Pricing
View Details
Human NADH-cytochrome b5 reductase 2 ELISA Kit
MBS9426389-01 96 Tests

Human NADH-cytochrome b5 reductase 2 ELISA Kit

Sign In for Pricing
View Details
Human NADH-cytochrome b5 reductase 2 ELISA Kit
MBS9426389-02 5x 96 Tests

Human NADH-cytochrome b5 reductase 2 ELISA Kit

Sign In for Pricing
View Details