Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Alpha-actinin-3 (ACTN3), partial

This Recombinant Human Alpha-actinin-3 (ACTN3), partial spans the amino acid sequence from region 158-264. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Alpha-actinin-3; Alpha-actinin skeletal muscle isoform 3; F-actin cross-linking protein; ACTN3

UniProt

Q08043

Expression Region

158-264

Origin

Homo sapiens (Human)

Field of Research

Musculoskeletal & Connective Tissue Research

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

TSAKEGLLLWCQRKTAPYRNVNVQNFHTSWKDGLALCALIHRHRPDLIDYAKLRKDDPIGNLNTAFEVAEKYLDIPKMLDAEDIVNTPKPDEKAIMTYVSCFYHAFA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

UR2R Rabbit Polyclonal Antibody
E28PN2704 100 µL

UR2R Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TP53RK (TP53-regulating Kinase, Nori-2, p53-related Protein Kinase, PRPK) (MaxLight 550)
MBS6214488-01 0.1 mL

TP53RK (TP53-regulating Kinase, Nori-2, p53-related Protein Kinase, PRPK) (MaxLight 550)

Sign In for Pricing
View Details
TP53RK (TP53-regulating Kinase, Nori-2, p53-related Protein Kinase, PRPK) (MaxLight 550)
MBS6214488-02 5x 0.1 mL

TP53RK (TP53-regulating Kinase, Nori-2, p53-related Protein Kinase, PRPK) (MaxLight 550)

Sign In for Pricing
View Details
Gm597 3'UTR Lenti-reporter-Luc Vector
22147084 1.0 µg

Gm597 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
3-Hydroxy-4-(1-naphthyloxy)-butanenitrile
TRC-H951065-25MG 25 mg

3-Hydroxy-4-(1-naphthyloxy)-butanenitrile

Sign In for Pricing
View Details
MRPL22 Antibody
DF3665-01 100 µL

MRPL22 Antibody

Sign In for Pricing
View Details