Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Mitotic-spindle organizing protein 1 (MZT1)

This Recombinant Human Mitotic-spindle organizing protein 1 (MZT1) spans the amino acid sequence from region 2-82. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Mitotic-spindle organizing protein 1; Mitotic-spindle organizing protein associated with a ring of gamma-tubulin 1; MZT1 C13orf37 MOZART1

UniProt

Q08AG7

Expression Region

2-82

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

ASSSGAGAAAAAAAANLNAVRETMDVLLEISRILNTGLDMETLSICVRLCEQGINPEALSSVIKELRKATEALKAAENMTS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Usp20 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K4479405 3x 1.0 µg

Usp20 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
Recombinant Yersinia pseudotuberculosis 1,4-alpha-glucan branching enzyme GlgB (glgB), partial
MBS1416643 Inquire

Recombinant Yersinia pseudotuberculosis 1,4-alpha-glucan branching enzyme GlgB (glgB), partial

Sign In for Pricing
View Details
Influenza A H1N1 (A/California/06/2009) Hemagglutinin/HA1 HEK293 Cell Lysate (WB positive control)
MBS8115991-01 0.3 mg

Influenza A H1N1 (A/California/06/2009) Hemagglutinin/HA1 HEK293 Cell Lysate (WB positive control)

Sign In for Pricing
View Details
Influenza A H1N1 (A/California/06/2009) Hemagglutinin/HA1 HEK293 Cell Lysate (WB positive control)
MBS8115991-02 5x 0.3 mg

Influenza A H1N1 (A/California/06/2009) Hemagglutinin/HA1 HEK293 Cell Lysate (WB positive control)

Sign In for Pricing
View Details
Mouse Ankyrin repeat domain containing protein 55 (ANKRD55) ELISA kit
GTR10389343 96 Well

Mouse Ankyrin repeat domain containing protein 55 (ANKRD55) ELISA kit

Sign In for Pricing
View Details
RPRD1B (C20orf77, CREPT, Regulation of Nuclear Pre-mRNA Domain-containing Protein 1B, Cell Cycle-related and Expression-elevated Protein in Tumor, DKFZp434P0735, FLJ44520) (HRP)
MBS6154741-01 0.1 mL

RPRD1B (C20orf77, CREPT, Regulation of Nuclear Pre-mRNA Domain-containing Protein 1B, Cell Cycle-related and Expression-elevated Protein in Tumor, DKFZp434P0735, FLJ44520) (HRP)

Sign In for Pricing
View Details