Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human ATP-binding cassette sub-family C member 8 (ABCC8), partial

This Recombinant Human ATP-binding cassette sub-family C member 8 (ABCC8), partial spans the amino acid sequence from region 320-356. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

ATP-binding cassette sub-family C member 8; Sulfonylurea receptor 1; ABCC8 HRINS SUR SUR1

UniProt

Q09428

Expression Region

320-356

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

IFGIVDHLGKENDVFQPKTQFLGVYFVSSQEFLANAY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal PSMA/FOLH1/NAALADase I Antibody (k1H7) [Janelia Fluor 549]
NBP1-04338JF549 0.1 mL

Mouse Monoclonal PSMA/FOLH1/NAALADase I Antibody (k1H7) [Janelia Fluor 549]

Sign In for Pricing
View Details
DYNC2H1 Knockout SK-HEP-1 Polyclonal Cells
ARG40156 1 Million

DYNC2H1 Knockout SK-HEP-1 Polyclonal Cells

Sign In for Pricing
View Details
CYP2A7P1 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)
LV759747 1.0 µg DNA

CYP2A7P1 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
RPLP1 (Ribosomal Protein, Large, P1, FLJ27448, MGC5215, P1, RPP1) (MaxLight 650)
251263-ML650 100 µL

RPLP1 (Ribosomal Protein, Large, P1, FLJ27448, MGC5215, P1, RPP1) (MaxLight 650)

Sign In for Pricing
View Details
hsa-miR-6502-5p miRNA Antagomir
MBS8317931-01 10 nmol

hsa-miR-6502-5p miRNA Antagomir

Sign In for Pricing
View Details
hsa-miR-6502-5p miRNA Antagomir
MBS8317931-02 20 nmol

hsa-miR-6502-5p miRNA Antagomir

Sign In for Pricing
View Details