Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Pappalysin-1 (PAPP1), partial

This Recombinant Human Pappalysin-1 (PAPP1), partial spans the amino acid sequence from region 1476-1556. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Pappalysin-1; EC 3.4.24.79; Insulin-like growth factor-dependent IGF-binding protein 4 protease; IGF-dependent IGFBP-4 protease; IGFBP-4ase; Pregnancy-associated plasma protein A; PAPP-A; PAPPA

UniProt

Q13219

Expression Region

1476-1556

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GQCSVPNELNSNLKLQCPDGYAIGSECATSCLDHNSESIILPMNVTVRDIPHWLNPTRVERVVCTAGLKWYPHPALIHCVK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nuclear Receptor Interacting Protein 2 (NRIP2) Antibody
abx301707-01 20 µg

Nuclear Receptor Interacting Protein 2 (NRIP2) Antibody

Sign In for Pricing
View Details
Nuclear Receptor Interacting Protein 2 (NRIP2) Antibody
abx301707-02 50 µg

Nuclear Receptor Interacting Protein 2 (NRIP2) Antibody

Sign In for Pricing
View Details
Nuclear Receptor Interacting Protein 2 (NRIP2) Antibody
abx301707-03 100 µg

Nuclear Receptor Interacting Protein 2 (NRIP2) Antibody

Sign In for Pricing
View Details
Nuclear Receptor Interacting Protein 2 (NRIP2) Antibody
abx301707-04 200 µg

Nuclear Receptor Interacting Protein 2 (NRIP2) Antibody

Sign In for Pricing
View Details
Nuclear Receptor Interacting Protein 2 (NRIP2) Antibody
abx301707-05 1 mg

Nuclear Receptor Interacting Protein 2 (NRIP2) Antibody

Sign In for Pricing
View Details
CD40 (MaxLight 750) discontinued
C2392-03-ML750 100 µL

CD40 (MaxLight 750) discontinued

Sign In for Pricing
View Details