Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human WAP four-disulfide core domain protein 2 (WFDC2)

This Recombinant Human WAP four-disulfide core domain protein 2 (WFDC2) spans the amino acid sequence from region 31-124. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

WAP four-disulfide core domain protein 2; Epididymal secretory protein E4; Major epididymis-specific protein E4; Putative protease inhibitor WAP5; WFDC2 HE4 WAP5

UniProt

Q14508

Expression Region

31-124

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EKTGVCPELQADQNCTQECVSDSECADNLKCCSAGCATFCSLPNDKEGSCPQVNINFPQLGLCRDQCQVDSQCPGQMKCCRNGCGKVSCVTPNF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-PNPT1 Antibody Picoband® (Biotine Conjugate)
A05460-1-Biotin 100 µg/Vial

Anti-PNPT1 Antibody Picoband® (Biotine Conjugate)

Sign In for Pricing
View Details
Colony Stimulating Factor 1 Receptor Phospho-Tyr699 (CSF1R pY699) Antibody
abx323260-01 50 µg

Colony Stimulating Factor 1 Receptor Phospho-Tyr699 (CSF1R pY699) Antibody

Sign In for Pricing
View Details
Colony Stimulating Factor 1 Receptor Phospho-Tyr699 (CSF1R pY699) Antibody
abx323260-02 100 µg

Colony Stimulating Factor 1 Receptor Phospho-Tyr699 (CSF1R pY699) Antibody

Sign In for Pricing
View Details
Rabbit Polyclonal MERS-CoV Spike Protein Antibody [Allophycocyanin]
NBP3-20217APC 0.1 mL

Rabbit Polyclonal MERS-CoV Spike Protein Antibody [Allophycocyanin]

Sign In for Pricing
View Details
Mouse Monoclonal MUC-1 Antibody (E29) [DyLight 550]
NBP2-34610R 0.1 mL

Mouse Monoclonal MUC-1 Antibody (E29) [DyLight 550]

Sign In for Pricing
View Details
Hsa-miR-345-5p miRNA Agomir
CMJ0200-01 5 nmol

Hsa-miR-345-5p miRNA Agomir

Sign In for Pricing
View Details