Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Periostin (POSTN), partial

This Recombinant Human Periostin (POSTN), partial spans the amino acid sequence from region 97-230. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Periostin; PN; Osteoblast-specific factor 2; OSF-2; POSTN OSF2

UniProt

Q15063

Expression Region

97-230

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

PIDHVYGTLGIVGATTTQRYSDASKLREEIEGKGSFTYFAPSNEAWDNLDSDIRRGLESNVNVELLNALHSHMINKRMLTKDLKNGMIIPSMYNNLGLFINHYPNGVVTVNCARIIHGNQIATNGVVHVIDRVL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

N- (2-Hydroxyethyl) 4-borono-2-fluorobenzamide
456918-01 25 mg

N- (2-Hydroxyethyl) 4-borono-2-fluorobenzamide

Sign In for Pricing
View Details
N- (2-Hydroxyethyl) 4-borono-2-fluorobenzamide
456918-02 50 mg

N- (2-Hydroxyethyl) 4-borono-2-fluorobenzamide

Sign In for Pricing
View Details
EIF2S1 (Ser51) Recombinant Rabbit mAb, APC conjugated
orb2353164 100 µL

EIF2S1 (Ser51) Recombinant Rabbit mAb, APC conjugated

Sign In for Pricing
View Details
Lentiviral mouse Vmn1r238 shRNA (UAS) - Lentiviral mouse Vmn1r238 shRNA (UAS, GFP) (100)
GTR15157437 1 Vial

Lentiviral mouse Vmn1r238 shRNA (UAS) - Lentiviral mouse Vmn1r238 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
Secretin (SCT) discontinued
S0625-05B 250 µL

Secretin (SCT) discontinued

Sign In for Pricing
View Details
5-Hydroxy-2- (trifluoromethyl) benzoic acid
TZB37331-01 50 mg

5-Hydroxy-2- (trifluoromethyl) benzoic acid

Sign In for Pricing
View Details