Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human SH2 domain-containing adapter protein B (SHB)

This Recombinant Human SH2 domain-containing adapter protein B (SHB) spans the amino acid sequence from region 1-509. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

SH2 domain-containing adapter protein B SHB

UniProt

Q15464

Expression Region

1-509

Origin

Homo sapiens (Human)

Field of Research

Musculoskeletal & Connective Tissue Research; Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MAKWLNKYFSLGNSKTKSPPQPPRPDYREQRRRGERPSQPPQAVPQASSAASASCGPATASCFSASSGSLPDDSGSTSDLIRAYRAQKERDFEDPYNGPGSSLRKLRAMCRLDYCGGSGEPGGVQRAFSASSASGAAGCCCASSGAGAAASSSSSSGSPHLYRSSSERRPATPAEVRYISPKHRLIKVESAAGGGAGDPLGGACAGGRTWSPTACGGKKLLNKCAASAAEESGAGKKDKVTIADDYSDPFDAKNDLKSKAGKGESAGYMEPYEAQRIMTEFQRQESVRSQHKGIQLYDTPYEPEGQSVDSDSESTVSPRLRESKLPQDDDRPADEYDQPWEWNRVTIPALAAQFNGNEKRQSSPSPSRDRRRQLRAPGGGFKPIKHGSPEFCGILGERVDPAVPLEKQIWYHGAISRGDAENLLRLCKECSYLVRNSQTSKHDYSLSLRSNQGFMHMKLAKTKEKYVLGQNSPPFDSVPEVIHYYTTRKLPIKGAEHLSLLYPVAVRTL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lyl1 Mouse Monoclonal Antibody
BF8518-01 100 µL

Lyl1 Mouse Monoclonal Antibody

Sign In for Pricing
View Details
Lyl1 Mouse Monoclonal Antibody
BF8518-02 200 µL

Lyl1 Mouse Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant Bacillus cereus UPF0042 nucleotide-binding protein BCA_5283 (BCA_5283)
MBS1092864-01 0.02 mg (E-Coli)

Recombinant Bacillus cereus UPF0042 nucleotide-binding protein BCA_5283 (BCA_5283)

Sign In for Pricing
View Details
Recombinant Bacillus cereus UPF0042 nucleotide-binding protein BCA_5283 (BCA_5283)
MBS1092864-02 0.02 mg (Yeast)

Recombinant Bacillus cereus UPF0042 nucleotide-binding protein BCA_5283 (BCA_5283)

Sign In for Pricing
View Details
Recombinant Bacillus cereus UPF0042 nucleotide-binding protein BCA_5283 (BCA_5283)
MBS1092864-03 0.1 mg (E-Coli)

Recombinant Bacillus cereus UPF0042 nucleotide-binding protein BCA_5283 (BCA_5283)

Sign In for Pricing
View Details
Recombinant Bacillus cereus UPF0042 nucleotide-binding protein BCA_5283 (BCA_5283)
MBS1092864-04 0.1 mg (Yeast)

Recombinant Bacillus cereus UPF0042 nucleotide-binding protein BCA_5283 (BCA_5283)

Sign In for Pricing
View Details