Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human SH2 domain-containing adapter protein B (SHB)

This Recombinant Human SH2 domain-containing adapter protein B (SHB) spans the amino acid sequence from region 1-509. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

SH2 domain-containing adapter protein B SHB

UniProt

Q15464

Expression Region

1-509

Origin

Homo sapiens (Human)

Field of Research

Musculoskeletal & Connective Tissue Research; Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MAKWLNKYFSLGNSKTKSPPQPPRPDYREQRRRGERPSQPPQAVPQASSAASASCGPATASCFSASSGSLPDDSGSTSDLIRAYRAQKERDFEDPYNGPGSSLRKLRAMCRLDYCGGSGEPGGVQRAFSASSASGAAGCCCASSGAGAAASSSSSSGSPHLYRSSSERRPATPAEVRYISPKHRLIKVESAAGGGAGDPLGGACAGGRTWSPTACGGKKLLNKCAASAAEESGAGKKDKVTIADDYSDPFDAKNDLKSKAGKGESAGYMEPYEAQRIMTEFQRQESVRSQHKGIQLYDTPYEPEGQSVDSDSESTVSPRLRESKLPQDDDRPADEYDQPWEWNRVTIPALAAQFNGNEKRQSSPSPSRDRRRQLRAPGGGFKPIKHGSPEFCGILGERVDPAVPLEKQIWYHGAISRGDAENLLRLCKECSYLVRNSQTSKHDYSLSLRSNQGFMHMKLAKTKEKYVLGQNSPPFDSVPEVIHYYTTRKLPIKGAEHLSLLYPVAVRTL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MTOR (Mammalian Target of Rapamycin, FRAP, FRAP1, FRAP2, RAFT1, RAPT1) (MaxLight 490)
MBS6427613-01 0.1 mL

MTOR (Mammalian Target of Rapamycin, FRAP, FRAP1, FRAP2, RAFT1, RAPT1) (MaxLight 490)

Sign In for Pricing
View Details
MTOR (Mammalian Target of Rapamycin, FRAP, FRAP1, FRAP2, RAFT1, RAPT1) (MaxLight 490)
MBS6427613-02 5x 0.1 mL

MTOR (Mammalian Target of Rapamycin, FRAP, FRAP1, FRAP2, RAFT1, RAPT1) (MaxLight 490)

Sign In for Pricing
View Details
Human Hyaluronan ELISA Kit
orb2991726 96 Tests

Human Hyaluronan ELISA Kit

Sign In for Pricing
View Details
GLIS3 Antibody - N-terminal region
ARP39924_T100-25UL 25 µL

GLIS3 Antibody - N-terminal region

Sign In for Pricing
View Details
STAT2 Antibody
KC-919-01 50 μL

STAT2 Antibody

Sign In for Pricing
View Details
STAT2 Antibody
KC-919-02 100 µL

STAT2 Antibody

Sign In for Pricing
View Details