Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human SH2 domain-containing adapter protein B (SHB)

This Recombinant Human SH2 domain-containing adapter protein B (SHB) spans the amino acid sequence from region 1-509. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

SH2 domain-containing adapter protein B SHB

UniProt

Q15464

Expression Region

1-509

Origin

Homo sapiens (Human)

Field of Research

Musculoskeletal & Connective Tissue Research; Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MAKWLNKYFSLGNSKTKSPPQPPRPDYREQRRRGERPSQPPQAVPQASSAASASCGPATASCFSASSGSLPDDSGSTSDLIRAYRAQKERDFEDPYNGPGSSLRKLRAMCRLDYCGGSGEPGGVQRAFSASSASGAAGCCCASSGAGAAASSSSSSGSPHLYRSSSERRPATPAEVRYISPKHRLIKVESAAGGGAGDPLGGACAGGRTWSPTACGGKKLLNKCAASAAEESGAGKKDKVTIADDYSDPFDAKNDLKSKAGKGESAGYMEPYEAQRIMTEFQRQESVRSQHKGIQLYDTPYEPEGQSVDSDSESTVSPRLRESKLPQDDDRPADEYDQPWEWNRVTIPALAAQFNGNEKRQSSPSPSRDRRRQLRAPGGGFKPIKHGSPEFCGILGERVDPAVPLEKQIWYHGAISRGDAENLLRLCKECSYLVRNSQTSKHDYSLSLRSNQGFMHMKLAKTKEKYVLGQNSPPFDSVPEVIHYYTTRKLPIKGAEHLSLLYPVAVRTL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Asb10 3'UTR Lenti-reporter-Luc Vector
12503086 1.0 µg

Asb10 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
APR3 Rabbit Polyclonal Antibody (FITC)
orb186722 100 µL

APR3 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
Flamma® 648 Isothiocyanate
KWI1215_5 mg 5 mg

Flamma® 648 Isothiocyanate

Sign In for Pricing
View Details
PFKFB1 Polyclonal Antibody, PE-Cy5 Conjugated
bs-5004R-PE-Cy5 100 µL

PFKFB1 Polyclonal Antibody, PE-Cy5 Conjugated

Sign In for Pricing
View Details
CASP1P2 Adenovirus (Human)
15068051 1.0 mL

CASP1P2 Adenovirus (Human)

Sign In for Pricing
View Details
Recombinant Nuphar advena Photosystem II CP47 chlorophyll apoprotein (psbB), partial
MBS7079717 Inquire

Recombinant Nuphar advena Photosystem II CP47 chlorophyll apoprotein (psbB), partial

Sign In for Pricing
View Details