Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Shieldin complex subunit 3 (SHLD3)

This Recombinant Human Shieldin complex subunit 3 (SHLD3) spans the amino acid sequence from region 1-250. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Shieldin complex subunit 3; REV7-interacting novel NHEJ regulator 1; Shield complex subunit 3; SHLD3 FLJ26957 RINN1

UniProt

Q6ZNX1

Expression Region

1-250

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MTTEVILHYRPCESDPTQLPKIAEKAIQDFPTRPLSRFIPWFPYDGSKLPLRPKRSPPVISEEAAEDVKQYLTISEHDAKSHSYDCTVDLLEFQPSLKKQHLTWSHTLKEQTNSGNLGKQSEKGKQHKRRSWSISLPSNNCTKNVSPLSKKLQDSLKALNLHSLYRARWTIEHTICNSQTLEDIWTKLNQIIRHNELPSCNATIQRHLGQIWVFCDIMYCEYVGSLLKGRLALTGKINLFVHKYGVIFSM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TEN1 (NM_001113324) Human Untagged Clone
SC318765 10 µg

TEN1 (NM_001113324) Human Untagged Clone

Sign In for Pricing
View Details
Human Malonyl CoA (Malonyl Coenzyme A) ELISA Kit
EK240359 96 Well

Human Malonyl CoA (Malonyl Coenzyme A) ELISA Kit

Sign In for Pricing
View Details
RPF2 Antibody (C-term)
MBS9203301-01 0.08 mL

RPF2 Antibody (C-term)

Sign In for Pricing
View Details
RPF2 Antibody (C-term)
MBS9203301-02 0.4 mL

RPF2 Antibody (C-term)

Sign In for Pricing
View Details
RPF2 Antibody (C-term)
MBS9203301-03 5x 0.4 mL

RPF2 Antibody (C-term)

Sign In for Pricing
View Details
Sheep Olfactory receptor 5B12 (OR5B12) ELISA Kit
MBS7231498-01 48 Well

Sheep Olfactory receptor 5B12 (OR5B12) ELISA Kit

Sign In for Pricing
View Details