Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Vitamin K epoxide reductase complex subunit 1 (VKOR1), partial

This Recombinant Human Vitamin K epoxide reductase complex subunit 1 (VKOR1), partial spans the amino acid sequence from region 30-80. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Vitamin K epoxide reductase complex subunit 1; EC 1.17.4.4; Vitamin K1 2,3-epoxide reductase subunit 1; VKORC1 VKOR MSTP134 MSTP576 UNQ308/PRO351

UniProt

Q9BQB6

Expression Region

30-80

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

KAARARDRDYRALCDVGTAISCSRVFSSRWGRGFGLVEHVLGQDSILNQSN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Picalm (NM_001252521) Mouse Tagged ORF Clone
MR230793 10 µg

Picalm (NM_001252521) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
3- (4H-1,2,4-Triazol-4-yl) propan-1-ol
sc-260460A 5 g

3- (4H-1,2,4-Triazol-4-yl) propan-1-ol

Sign In for Pricing
View Details
C10orf82 Antibody, HRP conjugated
A63039-100UG 100 µg

C10orf82 Antibody, HRP conjugated

Sign In for Pricing
View Details
CDC37 Antibody
orb675404-01 50 µg

CDC37 Antibody

Sign In for Pricing
View Details
CDC37 Antibody
orb675404-02 100 µg

CDC37 Antibody

Sign In for Pricing
View Details
AREBP Lentiviral Activation Particles (h)
sc-412566-LAC 200 µL

AREBP Lentiviral Activation Particles (h)

Sign In for Pricing
View Details