Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Selenoprotein S (SELS), partial

This Recombinant Human Selenoprotein S (SELS), partial spans the amino acid sequence from region 49-189. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Selenoprotein S; SelS; VCP-interacting membrane protein; SELENOS SELS VIMP AD-015 SBBI8

UniProt

Q9BQE4

Expression Region

49-189

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QKLSARLRALRQRQLDRAAAAVEPDVVVKRQEALAAARLKMQEELNAQVEKHKEKLKQLEEEKRRQKIEMWDSMQEGKSYKGNAKKPQEEDSPGPSTSSVLKRKSDRKPLRGGGYNPLSGEGGGACSWRPGRRGPSSGGUG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sp7 / Osterix Recombinant Rabbit monoclonal Antibody
HA751150 100 µL

Sp7 / Osterix Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
BAMBI Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5D5]
TA807759AM 100 µL

BAMBI Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5D5]

Sign In for Pricing
View Details
Pla2g5 (NM_011110) Mouse Tagged ORF Clone
MG200857 10 µg

Pla2g5 (NM_011110) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Human MIDN activation kit by CRISPRa
GA113968 1 Kit

Human MIDN activation kit by CRISPRa

Sign In for Pricing
View Details
p16INK4A (CDKN2A) Human Gene Knockout Kit (CRISPR)
KN211784BN 1 Kit

p16INK4A (CDKN2A) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
P14ARF (4C6/4), CF647 conjugate, 0.1mg/mL
BNC472088-100 1x 100 µL

P14ARF (4C6/4), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details