Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Neuronal-specific septin-3 (SEPT3)

This Recombinant Human Neuronal-specific septin-3 (SEPT3) spans the amino acid sequence from region 1-358. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Neuronal-specific septin-3 SEPTIN3 SEP3 SEPT3

UniProt

Q9UH03

Expression Region

1-358

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MSKGLPETRTDAAMSELVPEPRPKPAVPMKPMSINSNLLGYIGIDTIIEQMRKKTMKTGFDFNIMVVGQSGLGKSTLVNTLFKSQVSRKASSWNREEKIPKTVEIKAIGHVIEEGGVKMKLTVIDTPGFGDQINNENCWEPIEKYINEQYEKFLKEEVNIARKKRIPDTRVHCCLYFISPTGHSLRPLDLEFMKHLSKVVNIIPVIAKADTMTLEEKSEFKQRVRKELEVNGIEFYPQKEFDEDLEDKTENDKIRQESMPFAVVGSDKEYQVNGKRVLGRKTPWGIIEVENLNHCEFALLRDFVIRTHLQDLKEVTHNIHYETYRAKRLNDNGGLPPGEGLLGTVLPPVPATPCPTAE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant CD239 Antibody
RC-16054-01 50 μL

Recombinant CD239 Antibody

Sign In for Pricing
View Details
Recombinant CD239 Antibody
RC-16054-02 100 µL

Recombinant CD239 Antibody

Sign In for Pricing
View Details
Recombinant CD239 Antibody
RC-16054-03 1 mL

Recombinant CD239 Antibody

Sign In for Pricing
View Details
Human CHRDL2 activation kit by CRISPRa
GA108604 1 Kit

Human CHRDL2 activation kit by CRISPRa

Sign In for Pricing
View Details
GAP43 Antibody
KC-507-01 50 μL

GAP43 Antibody

Sign In for Pricing
View Details
GAP43 Antibody
KC-507-02 100 µL

GAP43 Antibody

Sign In for Pricing
View Details