Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Peptidyl-prolyl cis-trans isomerase NIMA-interacting 4 (PIN4)

This Recombinant Human Peptidyl-prolyl cis-trans isomerase NIMA-interacting 4 (PIN4) spans the amino acid sequence from region 1-131. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Peptidyl-prolyl cis-trans isomerase NIMA-interacting 4; EC 5.2.1.8; Parvulin-14; Par14; hPar14; Parvulin-17; Par17; hPar17; Peptidyl-prolyl cis-trans isomerase Pin4; PPIase Pin4; Peptidyl-prolyl cis/trans isomerase EPVH; hEPVH; Rotamase Pin4; PIN4

UniProt

Q9Y237

Expression Region

1-131

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MPPKGKSGSGKAGKGGAASGSDSADKKAQGPKGGGNAVKVRHILCEKHGKIMEAMEKLKSGMRFNEVAAQYSEDKARQGGDLGWMTRGSMVGPFQEAAFALPVSGMDKPVFTDPPVKTKFGYHIIMVEGRK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PA2G4 Polyclonal Antibody
E-AB-19268-01 20 µL

PA2G4 Polyclonal Antibody

Sign In for Pricing
View Details
PA2G4 Polyclonal Antibody
E-AB-19268-02 60 µL

PA2G4 Polyclonal Antibody

Sign In for Pricing
View Details
PA2G4 Polyclonal Antibody
E-AB-19268-03 120 µL

PA2G4 Polyclonal Antibody

Sign In for Pricing
View Details
PA2G4 Polyclonal Antibody
E-AB-19268-04 200 µL

PA2G4 Polyclonal Antibody

Sign In for Pricing
View Details
PRT 060318
TRC-P838895-1MG 1 mg

PRT 060318

Sign In for Pricing
View Details
Guanylyl Cyclase alpha 1 Recombinant Rabbit Monoclonal Antibody [JE34-21]
HA722537 100 µL

Guanylyl Cyclase alpha 1 Recombinant Rabbit Monoclonal Antibody [JE34-21]

Sign In for Pricing
View Details