Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Nuclear migration protein nudC (NUDC)

This Recombinant Human Nuclear migration protein nudC (NUDC) spans the amino acid sequence from region 1-331. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Nuclear migration protein nudC; Nuclear distribution protein C homolog; NUDC

UniProt

Q9Y266

Expression Region

1-331

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MGGEQEEERFDGMLLAMAQQHEGGVQELVNTFFSFLRRKTDFFIGGEEGMAEKLITQTFSHHNQLAQKTRREKRARQEAERREKAERAARLAKEAKSETSGPQIKELTDEEAERLQLEIDQKKDAENHEAQLKNGSLDSPGKQDTEEDEEEDEKDKGKLKPNLGNGADLPNYRWTQTLSELDLAVPFCVNFRLKGKDMVVDIQRRHLRVGLKGQPAIIDGELYNEVKVEESSWLIEDGKVVTVHLEKINKMEWWSRLVSSDPEINTKKINPENSKLSDLDSETRSMVEKMMYDQRQKSMGLPTSDEQKKQEILKKFMDQHPEMDFSKAKFN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RAE1 Antibody (N-Term)
MBS9215990-01 0.05 mL

RAE1 Antibody (N-Term)

Sign In for Pricing
View Details
RAE1 Antibody (N-Term)
MBS9215990-02 0.2 mL

RAE1 Antibody (N-Term)

Sign In for Pricing
View Details
RAE1 Antibody (N-Term)
MBS9215990-03 5x 0.2 mL

RAE1 Antibody (N-Term)

Sign In for Pricing
View Details
(3- (cyclopropylmethoxy) phenyl) (ethyl) sulfane
OR1091499-01 250 mg

(3- (cyclopropylmethoxy) phenyl) (ethyl) sulfane

Sign In for Pricing
View Details
(3- (cyclopropylmethoxy) phenyl) (ethyl) sulfane
OR1091499-02 500 mg

(3- (cyclopropylmethoxy) phenyl) (ethyl) sulfane

Sign In for Pricing
View Details
(3- (cyclopropylmethoxy) phenyl) (ethyl) sulfane
OR1091499-03 1 g

(3- (cyclopropylmethoxy) phenyl) (ethyl) sulfane

Sign In for Pricing
View Details