Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human PAT complex subunit Asterix (ASTER), partial

This Recombinant Human PAT complex subunit Asterix (ASTER), partial spans the amino acid sequence from region 2-32. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

PAT complex subunit Asterix; Protein associated with the ER translocon of 10kDa; PAT-10; PAT10; WD repeat domain 83 opposite strand; WDR83 opposite strand; WDR83OS C19orf56 CGI-140 My006 PTD008

UniProt

Q9Y284

Expression Region

2-32

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

STNNMSDPRRPNKVLRYKPPPSECNPALDDP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PTK2 Antibody, HRP conjugated
CSB-PA018994LB01HU-01 50 µg

PTK2 Antibody, HRP conjugated

Sign In for Pricing
View Details
PTK2 Antibody, HRP conjugated
CSB-PA018994LB01HU-02 100 µg

PTK2 Antibody, HRP conjugated

Sign In for Pricing
View Details
Phospho-c-Abl (Ser569) Rabbit Polyclonal Antibody (PerCP-Cy7)
orb1815676 100 µL

Phospho-c-Abl (Ser569) Rabbit Polyclonal Antibody (PerCP-Cy7)

Sign In for Pricing
View Details
RAD51C, ID (RAD51C, RAD51L2, DNA repair protein RAD51 homolog 3, RAD51 homolog C, RAD51-like protein 2) (Biotin) discontinued
040798-Biotin 200 µL

RAD51C, ID (RAD51C, RAD51L2, DNA repair protein RAD51 homolog 3, RAD51 homolog C, RAD51-like protein 2) (Biotin) discontinued

Sign In for Pricing
View Details
FRA1K Recombinant Protein (Human)
RP059310 100 µg

FRA1K Recombinant Protein (Human)

Sign In for Pricing
View Details
BMP4 Rabbit Monoclonal antibody
AMRe01731-01 1 Each

BMP4 Rabbit Monoclonal antibody

Sign In for Pricing
View Details