Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Sodium-dependent multivitamin transporter (SC5A6), partial

This Recombinant Human Sodium-dependent multivitamin transporter (SC5A6), partial spans the amino acid sequence from region 549-635. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Sodium-dependent multivitamin transporter; Na (+-dependent multivitamin transporter; hSMVT; Solute carrier family 5 member 6; SLC5A6 SMVT

UniProt

Q9Y289

Expression Region

549-635

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

TGRMRGRSLNPATIYPVLPKLLSLLPLSCQKRLHCRSYGQDHLDTGLFPEKPRNGVLGDSRDKEAMALDGTAYQGSSSTCILQETSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RGD1562551 3'UTR GFP Stable Cell Line
TU268603 1.0 mL

RGD1562551 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
ARID4A (AT-rich Interactive Domain-containing Protein 4A, ARID Domain-containing Protein 4A, Retinoblastoma-binding Protein 1, RBBP-1, RBBP1, RBP1)
123519 100 µg

ARID4A (AT-rich Interactive Domain-containing Protein 4A, ARID Domain-containing Protein 4A, Retinoblastoma-binding Protein 1, RBBP-1, RBBP1, RBP1)

Sign In for Pricing
View Details
KLF11 Protein Lysate (Mouse) with C-HA Tag
25741034 100 µg

KLF11 Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details
CPVL Human Over-expression Lysate
orb1370094 20 µg

CPVL Human Over-expression Lysate

Sign In for Pricing
View Details
Texas Red Conjugated Arum maculatum Lectin (Lords and Ladies) -AMA-
T-8012-1 1 mg

Texas Red Conjugated Arum maculatum Lectin (Lords and Ladies) -AMA-

Sign In for Pricing
View Details
Adam29 sgRNA CRISPR Lentivector set (Mouse)
K3593001 3x 1.0 µg

Adam29 sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details