Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Sodium-dependent multivitamin transporter (SC5A6), partial

This Recombinant Human Sodium-dependent multivitamin transporter (SC5A6), partial spans the amino acid sequence from region 549-635. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Sodium-dependent multivitamin transporter; Na (+-dependent multivitamin transporter; hSMVT; Solute carrier family 5 member 6; SLC5A6 SMVT

UniProt

Q9Y289

Expression Region

549-635

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

TGRMRGRSLNPATIYPVLPKLLSLLPLSCQKRLHCRSYGQDHLDTGLFPEKPRNGVLGDSRDKEAMALDGTAYQGSSSTCILQETSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

N1-a-L-Arabinopyranosylamino-guanidine HCl
292420-01 200 mg

N1-a-L-Arabinopyranosylamino-guanidine HCl

Sign In for Pricing
View Details
N1-a-L-Arabinopyranosylamino-guanidine HCl
292420-02 500 mg

N1-a-L-Arabinopyranosylamino-guanidine HCl

Sign In for Pricing
View Details
N1-a-L-Arabinopyranosylamino-guanidine HCl
292420-03 1 g

N1-a-L-Arabinopyranosylamino-guanidine HCl

Sign In for Pricing
View Details
N1-a-L-Arabinopyranosylamino-guanidine HCl
292420-04 2 g

N1-a-L-Arabinopyranosylamino-guanidine HCl

Sign In for Pricing
View Details
N1-a-L-Arabinopyranosylamino-guanidine HCl
292420-05 5 g

N1-a-L-Arabinopyranosylamino-guanidine HCl

Sign In for Pricing
View Details
2,3,4-Tri-O-acetyl-a-L-fucopyranosyl bromide
MT04461-01 0.25 g

2,3,4-Tri-O-acetyl-a-L-fucopyranosyl bromide

Sign In for Pricing
View Details