Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human E3 ubiquitin-protein ligase DTX4 (DTX4)

This Recombinant Human E3 ubiquitin-protein ligase DTX4 (DTX4) spans the amino acid sequence from region 1-619. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

E3 ubiquitin-protein ligase DTX4; EC 2.3.2.27; Protein deltex-4; Deltex4; RING finger protein 155; RING-type E3 ubiquitin transferase DTX4; DTX4 KIAA0937 RNF155

UniProt

Q9Y2E6

Expression Region

1-619

Origin

Homo sapiens (Human)

Field of Research

Molecular Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MLLASAVVVWEWLNEHGRWRPYSPAVSHHIEAVVRAGPRAGGSVVLGQVDSRLAPYIIDLQSMNQFRQDTGTLRPVRRNYYDPSSAPGKGVVWEWENDNGSWTPYDMEVGITIQHAYEKQHPWIDLTSIGFSYVIDFNTMGQINRQTQRQRRVRRRLDLIYPMVTGTLPKAQSWPVSPGPATSPPMSPCSCPQCVLVMSVKAAVVNGSTGPLQLPVTRKNMPPPGVVKLPPLPGSGAKPLDSTGTIRGPLKTAPSQVIRRQASSMPTGTTMGSPASPPGPNSKTGRVALATLNRTNLQRLAIAQSRVLIASGVPTVPVKNLNGSSPVNPALAGITGILMSAAGLPVCLTRPPKLVLHPPPVSKSEIKSIPGVSNTSRKTTKKQAKKGKTPEEVLKKYLQKVRHPPDEDCTICMERLTAPSGYKGPQPTVKPDLVGKLSRCGHVYHIYCLVAMYNNGNKDGSLQCPTCKTIYGVKTGTQPPGKMEYHLIPHSLPGHPDCKTIRIIYSIPPGIQGPEHPNPGKSFSARGFPRHCYLPDSEKGRKVLKLLLVAWDRRLIFAIGTSSTTGESDTVIWNEVHHKTEFGSNLTGHGYPDANYLDNVLAELAAQGISEDSTAQEKD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPS11P3 sgRNA CRISPR Lentivector set (Human)
K2023801 3x 1.0 µg

RPS11P3 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
PSMC5 Rabbit Polyclonal Antibody
HA500352 100 µL

PSMC5 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
GPR108 Protein Vector (Mouse) (pPM-C-HA)
22483024 500 ng

GPR108 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Uchl1 siRNA Oligos set (Mouse)
49072174 3x 5 nmol

Uchl1 siRNA Oligos set (Mouse)

Sign In for Pricing
View Details
TAS1R3 Peptide
42-760P 0.1 mg

TAS1R3 Peptide

Sign In for Pricing
View Details
anti-delta Sarcoglycan
YF-PA14617 100 ul

anti-delta Sarcoglycan

Sign In for Pricing
View Details