Recombinant Human Transmembrane emp24 domain-containing protein 5 (TMED5), partial
This Recombinant Human Transmembrane emp24 domain-containing protein 5 (TMED5), partial spans the amino acid sequence from region 28-196. Purity: Greater than 85% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Transmembrane emp24 domain-containing protein 5; p24 family protein gamma-2; p24gamma2; p28; TMED5 CGI-100 UNQ397/PRO733
UniProt
Q9Y3A6
Expression Region
28-196
Origin
Homo sapiens (Human)
Field of Research
Cell Biology
Endotoxin
Not test
Purity
Greater than 85% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Storage Conditions
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
AA Sequence
FTPSLDSDFTFTLPAGQKECFYQPMPLKASLEIEYQVLDGAGLDIDFHLASPEGKTLVFEQRKSDGVHTVETEVGDYMFCFDNTFSTISEKVIFFELILDNMGEQAQEQEDWKKYITGTDILDMKLEDILESINSIKSRLSKSGHIQTLLRAFEARDRNIQESNFDRVN
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
