Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Oligoribonuclease, mitochondrial (ORN)

This Recombinant Human Oligoribonuclease, mitochondrial (ORN) spans the amino acid sequence from region 26-237. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Oligoribonuclease, mitochondrial; EC 3.1.15.-; RNA exonuclease 2 homolog; Small fragment nuclease; REXO2 SFN SMFN CGI-114

UniProt

Q9Y3B8

Expression Region

26-237

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

VREGGAAMAAGESMAQRMVWVDLEMTGLDIEKDQIIEMACLITDSDLNILAEGPNLIIKQPDELLDSMSDWCKEHHGKSGLTKAVKESTITLQQAEYEFLSFVRQQTPPGLCPLAGNSVHEDKKFLDKYMPQFMKHLHYRIIDVSTVKELCRRWYPEEYEFAPKKAASHRALDDISESIKELQFYRNNIFKKKIDEKKRKIIENGENEKTVS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF228 Blocking Peptide
33R-9843 0.1 mg

ZNF228 Blocking Peptide

Sign In for Pricing
View Details
HIV-1 tat Protein (1-9)
orb2942715-01 1 mg

HIV-1 tat Protein (1-9)

Sign In for Pricing
View Details
HIV-1 tat Protein (1-9)
orb2942715-02 5 mg

HIV-1 tat Protein (1-9)

Sign In for Pricing
View Details
TIMP1 Antibody
E033502 100 µg -100 µL

TIMP1 Antibody

Sign In for Pricing
View Details
ILDR2, Recombinant, Human, aa1-186, His-Tag (Immunoglobulin-like Domain-containing Receptor 2)
373841-01 20 µg

ILDR2, Recombinant, Human, aa1-186, His-Tag (Immunoglobulin-like Domain-containing Receptor 2)

Sign In for Pricing
View Details
ILDR2, Recombinant, Human, aa1-186, His-Tag (Immunoglobulin-like Domain-containing Receptor 2)
373841-02 100 µg

ILDR2, Recombinant, Human, aa1-186, His-Tag (Immunoglobulin-like Domain-containing Receptor 2)

Sign In for Pricing
View Details