Recombinant Human Mediator of RNA polymerase II transcription subunit 31 (MED31)
Selected Variant
GTR19132096-01
Size: 20 µg
This Recombinant Human Mediator of RNA polymerase II transcription subunit 31 (MED31) spans the amino acid sequence from region 2-131. Purity: Greater than 85% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Mediator of RNA polymerase II transcription subunit 31; Mediator complex subunit 31; Mediator complex subunit SOH1; hSOH1; MED31 SOH1 CGI-125
UniProt
Q9Y3C7
Expression Region
2-131
Origin
Homo sapiens (Human)
Field of Research
Molecular Biology
Endotoxin
Not test
Purity
Greater than 85% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Storage Conditions
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
AA Sequence
AAAVAMETDDAGNRLRFQLELEFVQCLANPNYLNFLAQRGYFKDKAFVNYLKYLLYWKDPEYAKYLKYPQCLHMLELLQYEHFRKELVNAQCAKFIDEQQILHWQHYSRKRMRLQQALAEQQQQNNTSGK
Available Sizes
Price
Sign In for Pricing
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNCB1816-500 1x 500 µL
Histone H1 (Pan Nuclear Marker) (N/A), Biotin conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC470103-100 1x 100 µL
P55;50 EBV-Early Antigen (1108-1), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC881553-100 1x 100 µL
MUC6 (Mucin 6 / Gastric Mucin) (MUC6/1553R), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details ![Phospho-GCN2 (T899) Recombinant Rabbit Monoclonal Antibody [JE00-51]](https://cdn.genprice.uk/products/992/68dd1c90061270361ea82b5e/imageurl/ha722249.webp)
HA722249 100 µL
Phospho-GCN2 (T899) Recombinant Rabbit Monoclonal Antibody [JE00-51]
Sign In for Pricing
View Details 
BNC742316-100 1x 100 µL
Cdk2 / p34cdc2 Serine-Threonine Kinase (AN4.3), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
PB9982-iFluor647 100 µg
Anti-ALDH3A2 Antibody Picoband® (iFluor647 Conjugate)
Sign In for Pricing
View Details