Recombinant Human Mediator of RNA polymerase II transcription subunit 31 (MED31)
This Recombinant Human Mediator of RNA polymerase II transcription subunit 31 (MED31) spans the amino acid sequence from region 2-131. Purity: Greater than 85% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Mediator of RNA polymerase II transcription subunit 31; Mediator complex subunit 31; Mediator complex subunit SOH1; hSOH1; MED31 SOH1 CGI-125
UniProt
Q9Y3C7
Expression Region
2-131
Origin
Homo sapiens (Human)
Field of Research
Molecular Biology
Endotoxin
Not test
Purity
Greater than 85% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Storage Conditions
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
AA Sequence
AAAVAMETDDAGNRLRFQLELEFVQCLANPNYLNFLAQRGYFKDKAFVNYLKYLLYWKDPEYAKYLKYPQCLHMLELLQYEHFRKELVNAQCAKFIDEQQILHWQHYSRKRMRLQQALAEQQQQNNTSGK
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC940009-500 1x 500 µL
MART-1 / Melan-A (M2-7C10), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC682853-500 1x 500 µL
CD54 / ICAM-1 (15.2), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400276-500 1x 500 µL
TAG-72 / CA72.4 (B72.3), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC680043-100 1x 100 µL
P21 / WAF1 (WA-1), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 