Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human F-box only protein 7 (FBX7)

This Recombinant Human F-box only protein 7 (FBX7) spans the amino acid sequence from region 1-522. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

F-box only protein 7 FBXO7 FBX7

UniProt

Q9Y3I1

Expression Region

1-522

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MRLRVRLLKRTWPLEVPETEPTLGHLRSHLRQSLLCTWGYSSNTRFTITLNYKDPLTGDEETLASYGIVSGDLICLILQDDIPAPNIPSSTDSEHSSLQNNEQPSLATSSNQTSMQDEQPSDSFQGQAAQSGVWNDDSMLGPSQNFEAESIQDNAHMAEGTGFYPSEPMLCSESVEGQVPHSLETLYQSADCSDANDALIVLIHLLMLESGYIPQGTEAKALSMPEKWKLSGVYKLQYMHPLCEGSSATLTCVPLGNLIVVNATLKINNEIRSVKRLQLLPESFICKEKLGENVANIYKDLQKLSRLFKDQLVYPLLAFTRQALNLPDVFGLVVLPLELKLRIFRLLDVRSVLSLSAVCRDLFTASNDPLLWRFLYLRDFRDNTVRVQDTDWKELYRKRHIQRKESPKGRFVMLLPSSTHTIPFYPNPLHPRPFPSSRLPPGIIGGEYDQRPTLPYVGDPISSLIPGPGETPSQFPPLRPRFDPVGPLPGPNPILPGRGGPNDRFPFRPSRGRPTDGRLSFM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD81 / TAPA-1 (1.3.3.22), CF640R conjugate, 0.1mg/mL
BNC400391-100 1x 100 µL

CD81 / TAPA-1 (1.3.3.22), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Major Vault Protein (MVP) (1032), CF568 conjugate, 0.1mg/mL
BNC680225-100 1x 100 µL

Major Vault Protein (MVP) (1032), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD63 (MX-49.129.5), CF555 conjugate, 0.1mg/mL
BNC550525-500 1x 500 µL

CD63 (MX-49.129.5), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TNF alpha (J2D10), CF405S conjugate, 0.1mg/mL
BNC040994-500 1x 500 µL

TNF alpha (J2D10), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FOXP3 (3G3), CF594 conjugate, 0.1mg/mL
BNC940645-100 1x 100 µL

FOXP3 (3G3), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45 / LCA (2B11 + PD7/26), CF488A conjugate, 0.1mg/mL
BNC880745-500 1x 500 µL

CD45 / LCA (2B11 + PD7/26), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details