Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Signaling threshold-regulating transmembrane adapter 1 (SIT1), partial

This Recombinant Human Signaling threshold-regulating transmembrane adapter 1 (SIT1), partial spans the amino acid sequence from region 62-196. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Signaling threshold-regulating transmembrane adapter 1; SHP2-interacting transmembrane adapter protein; Suppression-inducing transmembrane adapter 1; gp30/40; SIT1 SIT

UniProt

Q9Y3P8

Expression Region

62-196

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

HLSQWTRGRSRSHPGQGRSGESVEEVPLYGNLHYLQTGRLSQDPEPDQQDPTLGGPARAAEEVMCYTSLQLRPPQGRIPGPGTPVKYSEVVLDSEPKSQASGPEPELYASVCAQTRRARASFPDQAYANSQPAAS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Neuromedin B (NMB)
TRV-0062461-01 10 µg

Recombinant Neuromedin B (NMB)

Sign In for Pricing
View Details
Recombinant Neuromedin B (NMB)
TRV-0062461-02 50 µg

Recombinant Neuromedin B (NMB)

Sign In for Pricing
View Details
Recombinant Neuromedin B (NMB)
TRV-0062461-03 100 µg

Recombinant Neuromedin B (NMB)

Sign In for Pricing
View Details
Recombinant Neuromedin B (NMB)
TRV-0062461-04 200 µg

Recombinant Neuromedin B (NMB)

Sign In for Pricing
View Details
Recombinant Neuromedin B (NMB)
TRV-0062461-05 500 µg

Recombinant Neuromedin B (NMB)

Sign In for Pricing
View Details
Recombinant Neuromedin B (NMB)
TRV-0062461-06 1 mg

Recombinant Neuromedin B (NMB)

Sign In for Pricing
View Details