Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Unconventional myosin-Va (MYO5A), partial

This Recombinant Human Unconventional myosin-Va (MYO5A), partial spans the amino acid sequence from region 69-763. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Unconventional myosin-Va; Dilute myosin heavy chain, non-muscle; Myosin heavy chain 12; Myosin-12; Myoxin; MYO5A MYH12

UniProt

Q9Y4I1

Expression Region

69-763

Origin

Homo sapiens (Human)

Field of Research

Musculoskeletal & Connective Tissue Research

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

VGENDLTALSYLHEPAVLHNLRVRFIDSKLIYTYCGIVLVAINPYEQLPIYGEDIINAYSGQNMGDMDPHIFAVAEEAYKQMARDERNQSIIVSGESGAGKTVSAKYAMRYFATVSGSASEANVEEKVLASNPIMESIGNAKTTRNDNSSRFGKYIEIGFDKRYRIIGANMRTYLLEKSRVVFQAEEERNYHIFYQLCASAKLPEFKMLRLGNADNFNYTKQGGSPVIEGVDDAKEMAHTRQACTLLGISESHQMGIFRILAGILHLGNVGFTSRDADSCTIPPKHEPLCIFCELMGVDYEEMCHWLCHRKLATATETYIKPISKLQATNARDALAKHIYAKLFNWIVDNVNQALHSAVKQHSFIGVLDIYGFETFEINSFEQFCINYANEKLQQQFNMHVFKLEQEEYMKEQIPWTLIDFYDNQPCINLIESKLGILDLLDEECKMPKGTDDTWAQKLYNTHLNKCALFEKPRLSNKAFIIQHFADKVEYQCEGFLEKNKDTVFEEQIKVLKSSKFKMLPELFQDDEKAISPTSATSSGRTPLTRTPAKPTKGRPGQMAKEHKKTVGHQFRNSLHLLMETLNATTPHYVRCIKPNDFKFPFTFDEKRAVQQLRACGVLETIRISAAGFPSRWTYQEFFSRYRVLMKQKDVLSDRKQTCKNVLEKLILDKDKYQFGKTKIFFRAGQVAYLEKLRA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GOLGA8E sgRNA CRISPR Lentivector (Human) (Target 3)
K0882304 1.0 µg DNA

GOLGA8E sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
ZNF417 Human qPCR Primer Pair (NM_152475)
HP217734 200 Reactions

ZNF417 Human qPCR Primer Pair (NM_152475)

Sign In for Pricing
View Details
EGFR Recombinant Antibody, AbBy Fluor™ 750 Conjugated
bsm-52317R-BF750-TR 20 µL

EGFR Recombinant Antibody, AbBy Fluor™ 750 Conjugated

Sign In for Pricing
View Details
Lentiviral mouse Fam199x shRNA (UAS) - Lentiviral mouse Fam199x shRNA (UAS) (25)
GTR15275093 1 Vial

Lentiviral mouse Fam199x shRNA (UAS) - Lentiviral mouse Fam199x shRNA (UAS) (25)

Sign In for Pricing
View Details
Lentiviral human ZMAT4 shRNA (UAS) - Lentiviral human ZMAT4 shRNA (UAS) (25)
GTR15148673 1 Vial

Lentiviral human ZMAT4 shRNA (UAS) - Lentiviral human ZMAT4 shRNA (UAS) (25)

Sign In for Pricing
View Details
RAPGEF1 Protein Lysate
OCOA03991-20UG 20 µg

RAPGEF1 Protein Lysate

Sign In for Pricing
View Details