Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Claudin-16 (CLD16), partial

This Recombinant Human Claudin-16 (CLD16), partial spans the amino acid sequence from region 25-79. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Claudin-16; Paracellin-1; PCLN-1; CLDN16 PCLN1

UniProt

Q9Y5I7

Expression Region

25-79

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

WTDCWMVNADDSLEVSTKCRGLWWECVTNAFDGIRTCDEYDSILAEHPLKLVVTR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DDX19A Protein Vector (Rat) (pPM-C-His)
PV263481 500 ng

DDX19A Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details
GTP - Solid
orb1734192 10 g

GTP - Solid

Sign In for Pricing
View Details
Seneganolide
MBS5787352 Inquire

Seneganolide

Sign In for Pricing
View Details
PEX1 Antibody : HRP (OAAF04000-HRP)
OAAF04000-100UG-HRP 100 µg

PEX1 Antibody : HRP (OAAF04000-HRP)

Sign In for Pricing
View Details
Cystatin C Mouse Monoclonal Antibody (5A2)
44156 50 µL

Cystatin C Mouse Monoclonal Antibody (5A2)

Sign In for Pricing
View Details
Mouse [Ala1] PAR-4 peptide
orb233775-01 1 mg

Mouse [Ala1] PAR-4 peptide

Sign In for Pricing
View Details