Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Claudin-16 (CLD16), partial

This Recombinant Human Claudin-16 (CLD16), partial spans the amino acid sequence from region 25-79. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Claudin-16; Paracellin-1; PCLN-1; CLDN16 PCLN1

UniProt

Q9Y5I7

Expression Region

25-79

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

WTDCWMVNADDSLEVSTKCRGLWWECVTNAFDGIRTCDEYDSILAEHPLKLVVTR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

c-erbB2 (HER-2, neu Receptor) (BSA & Azide Free) (Biotin)
MBS6266274-01 0.1 mL

c-erbB2 (HER-2, neu Receptor) (BSA & Azide Free) (Biotin)

Sign In for Pricing
View Details
c-erbB2 (HER-2, neu Receptor) (BSA & Azide Free) (Biotin)
MBS6266274-02 5x 0.1 mL

c-erbB2 (HER-2, neu Receptor) (BSA & Azide Free) (Biotin)

Sign In for Pricing
View Details
TOM1L1 Antibody Blocking Peptide
orb1513065 500 µg

TOM1L1 Antibody Blocking Peptide

Sign In for Pricing
View Details
CBX8 (Chromobox Homolog 8)
477205 100 µL

CBX8 (Chromobox Homolog 8)

Sign In for Pricing
View Details
RAG1AP1 CRISPR/Cas9 KO Plasmid (h)
sc-412645 20 µg

RAG1AP1 CRISPR/Cas9 KO Plasmid (h)

Sign In for Pricing
View Details
FUDR
40690016-1 1 g

FUDR

Sign In for Pricing
View Details