Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Claudin-16 (CLD16), partial

This Recombinant Human Claudin-16 (CLD16), partial spans the amino acid sequence from region 25-79. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Claudin-16; Paracellin-1; PCLN-1; CLDN16 PCLN1

UniProt

Q9Y5I7

Expression Region

25-79

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

WTDCWMVNADDSLEVSTKCRGLWWECVTNAFDGIRTCDEYDSILAEHPLKLVVTR

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

HB EGF (HBEGF) (NM_001945) Human Over-expression Lysate
LY400718 100 µg

HB EGF (HBEGF) (NM_001945) Human Over-expression Lysate

Sign In for Pricing
View Details
C2CD2 Double Nickase Plasmid (m2)
sc-431519-NIC-2 20 µg

C2CD2 Double Nickase Plasmid (m2)

Sign In for Pricing
View Details
Human P-Selectin Glycoprotein Ligand 1 (PSGL1) ELISA Kit
RDR-PSGL1-Hu-01 96 Tests

Human P-Selectin Glycoprotein Ligand 1 (PSGL1) ELISA Kit

Sign In for Pricing
View Details
Human P-Selectin Glycoprotein Ligand 1 (PSGL1) ELISA Kit
RDR-PSGL1-Hu-02 48 Tests

Human P-Selectin Glycoprotein Ligand 1 (PSGL1) ELISA Kit

Sign In for Pricing
View Details
Nafcillin Sulfoxide
TRC-N211505-10MG 10 mg

Nafcillin Sulfoxide

Sign In for Pricing
View Details
Sumo2/3 Recombinant Antibody, AbBy Fluor™ 405 Conjugated
bsm-61351R-BF405-TR 20 µL

Sumo2/3 Recombinant Antibody, AbBy Fluor™ 405 Conjugated

Sign In for Pricing
View Details