Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Claudin-16 (CLD16), partial

This Recombinant Human Claudin-16 (CLD16), partial spans the amino acid sequence from region 25-79. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Claudin-16; Paracellin-1; PCLN-1; CLDN16 PCLN1

UniProt

Q9Y5I7

Expression Region

25-79

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

WTDCWMVNADDSLEVSTKCRGLWWECVTNAFDGIRTCDEYDSILAEHPLKLVVTR

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

STAG3 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
45668111 3x 1.0 µg

STAG3 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
MIOX Antibody (YA7931, Mouse)
HY-P88247-01 10 µL

MIOX Antibody (YA7931, Mouse)

Sign In for Pricing
View Details
MIOX Antibody (YA7931, Mouse)
HY-P88247-02 50 μL

MIOX Antibody (YA7931, Mouse)

Sign In for Pricing
View Details
MIOX Antibody (YA7931, Mouse)
HY-P88247-03 100 µL

MIOX Antibody (YA7931, Mouse)

Sign In for Pricing
View Details
CruzFluor sm™ 6 maleimide
sc-362605 1 mg

CruzFluor sm™ 6 maleimide

Sign In for Pricing
View Details
FAM73A (MIGA1) (NM_001270384) Human Tagged ORF Clone
RC233032 10 µg

FAM73A (MIGA1) (NM_001270384) Human Tagged ORF Clone

Sign In for Pricing
View Details