Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Choline-phosphate cytidylyltransferase B (PCY1B)

This Recombinant Human Choline-phosphate cytidylyltransferase B (PCY1B) spans the amino acid sequence from region 1-369. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Choline-phosphate cytidylyltransferase B; EC 2.7.7.15; CCT-beta; CTP:phosphocholine cytidylyltransferase B; CCT B; CT B; Phosphorylcholine transferase B; PCYT1B CCTB

UniProt

Q9Y5K3

Expression Region

1-369

Origin

Homo sapiens (Human)

Field of Research

Pharmacology & Drug Discovery

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MPVVTTDAESETGIPKSLSNEPPSETMEEIEHTCPQPRLTLTAPAPFADETNCQCQAPHEKLTIAQARLGTPADRPVRVYADGIFDLFHSGHARALMQAKTLFPNSYLLVGVCSDDLTHKFKGFTVMNEAERYEALRHCRYVDEVIRDAPWTLTPEFLEKHKIDFVAHDDIPYSSAGSDDVYKHIKEAGMFVPTQRTEGISTSDIITRIVRDYDVYARRNLQRGYTAKELNVSFINEKRYRFQNQVDKMKEKVKNVEERSKEFVNRVEEKSHDLIQKWEEKSREFIGNFLELFGPDGAWKQMFQERSSRMLQALSPKQSPVSSPTRSRSPSRSPSPTFSWLPLKTSPPSSPKAASASISSMSEGDEDEK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zfp628 AAV siRNA Pooled Vector
51058164 1.0 µg

Zfp628 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
UGT1A6 Antibody
43176 100 µL

UGT1A6 Antibody

Sign In for Pricing
View Details
N-Desmethyl Imatinib (CGP-74588)
D3220-88R 1 mg

N-Desmethyl Imatinib (CGP-74588)

Sign In for Pricing
View Details
D-Fructose-6-phosphate (sodium salt)
A9939-50 50 mg

D-Fructose-6-phosphate (sodium salt)

Sign In for Pricing
View Details
Rat CASP1 (Caspase 1) ELISA Kit
E-EL-R0371-01 24 Tests

Rat CASP1 (Caspase 1) ELISA Kit

Sign In for Pricing
View Details
Rat CASP1 (Caspase 1) ELISA Kit
E-EL-R0371-02 48 Tests

Rat CASP1 (Caspase 1) ELISA Kit

Sign In for Pricing
View Details