Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immediate early response 3-interacting protein 1 (IR3IP), partial

This Recombinant Human Immediate early response 3-interacting protein 1 (IR3IP), partial spans the amino acid sequence from region 23-61. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immediate early response 3-interacting protein 1 IER3IP1 HSPC039

UniProt

Q9Y5U9

Expression Region

23-61

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

HEERFLKNIGWGTDQGIGGFGEEPGIKSQLMNLIRSVRT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dok-1 (phospho Tyr362) Polyclonal Antibody
MBS9241957-01 0.1 mL

Dok-1 (phospho Tyr362) Polyclonal Antibody

Sign In for Pricing
View Details
Dok-1 (phospho Tyr362) Polyclonal Antibody
MBS9241957-02 5x 0.1 mL

Dok-1 (phospho Tyr362) Polyclonal Antibody

Sign In for Pricing
View Details
GRIK4 Antibody, HRP conjugated
CSB-PA619054LB01HU-01 50 µg

GRIK4 Antibody, HRP conjugated

Sign In for Pricing
View Details
GRIK4 Antibody, HRP conjugated
CSB-PA619054LB01HU-02 100 µg

GRIK4 Antibody, HRP conjugated

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Catenin Beta 1 (CTNNb1)
MBS2092787-01 0.1 mL

Biotin-Linked Polyclonal Antibody to Catenin Beta 1 (CTNNb1)

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Catenin Beta 1 (CTNNb1)
MBS2092787-02 0.2 mL

Biotin-Linked Polyclonal Antibody to Catenin Beta 1 (CTNNb1)

Sign In for Pricing
View Details