Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Sorting nexin-5 (SNX5)

This Recombinant Human Sorting nexin-5 (SNX5) spans the amino acid sequence from region 2-404. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Sorting nexin-5 SNX5

UniProt

Q9Y5X3

Expression Region

2-404

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

AAVPELLQQQEEDRSKLRSVSVDLNVDPSLQIDIPDALSERDKVKFTVHTKTTLPTFQSPEFSVTRQHEDFVWLHDTLIETTDYAGLIIPPAPTKPDFDGPREKMQKLGEGEGSMTKEEFAKMKQELEAEYLAVFKKTVSSHEVFLQRLSSHPVLSKDRNFHVFLEYDQDLSVRRKNTKEMFGGFFKSVVKSADEVLFTGVKEVDDFFEQEKNFLINYYNRIKDSCVKADKMTRSHKNVADDYIHTAACLHSLALEEPTVIKKYLLKVAELFEKLRKVEGRVSSDEDLKLTELLRYYMLNIEAAKDLLYRRTKALIDYENSNKALDKARLKSKDVKLAEAHQQECCQKFEQLSESAKEELINFKRKRVAAFRKNLIEMSELEIKHARNNVSLLQSCIDLFKNN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(S)-N-Benzyl-1,4-oxazepan-6-ol
TRC-B285335-50MG 50 mg

(S)-N-Benzyl-1,4-oxazepan-6-ol

Sign In for Pricing
View Details
EIF2B3 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1A4]
TA503758BM 100 µL

EIF2B3 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1A4]

Sign In for Pricing
View Details
CEP43 Antibody
KC-2228-01 50 μL

CEP43 Antibody

Sign In for Pricing
View Details
CEP43 Antibody
KC-2228-02 100 µL

CEP43 Antibody

Sign In for Pricing
View Details
CEP43 Antibody
KC-2228-03 1 mL

CEP43 Antibody

Sign In for Pricing
View Details
Recombinant EAAT1 Antibody
RC-15197-01 50 μL

Recombinant EAAT1 Antibody

Sign In for Pricing
View Details