Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human UbiA prenyltransferase domain-containing protein 1 (UBIA1), partial

This Recombinant Human UbiA prenyltransferase domain-containing protein 1 (UBIA1), partial spans the amino acid sequence from region 2-82. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

UbiA prenyltransferase domain-containing protein 1; EC 2.5.1.-; EC 2.5.1.39; Transitional epithelial response protein 1; UBIAD1 TERE1

UniProt

Q9Y5Z9

Expression Region

2-82

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

AASQVLGEKINILSGETVKAGDRDPLGNDCPEQDRLPQRSWRQKCASYVLALRPWSFSASLTPVALGSALAYRSHGVLDPR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rad50 Recombinant Rabbit mAb
orb2326813-01 25 µL

Rad50 Recombinant Rabbit mAb

Sign In for Pricing
View Details
Rad50 Recombinant Rabbit mAb
orb2326813-02 50 µL

Rad50 Recombinant Rabbit mAb

Sign In for Pricing
View Details
Rad50 Recombinant Rabbit mAb
orb2326813-03 100 µL

Rad50 Recombinant Rabbit mAb

Sign In for Pricing
View Details
SL9C1 Polyclonal Antibody
UB-GEN-6070 100 µL

SL9C1 Polyclonal Antibody

Sign In for Pricing
View Details
Bcl-6 (Follicular Lymphoma Marker) (BCL6/1475), Biotin conjugate, 0.1mg/mL
BNCB1475-500 1x 500 µL

Bcl-6 (Follicular Lymphoma Marker) (BCL6/1475), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Peroxiredoxin 2 (PRDX2) (NM_181738) Human Over-expression Lysate
E45H15793-2 20 µg

Peroxiredoxin 2 (PRDX2) (NM_181738) Human Over-expression Lysate

Sign In for Pricing
View Details