Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Solute carrier family 12 member 7 (S12A7), partial

This Recombinant Human Solute carrier family 12 member 7 (S12A7), partial spans the amino acid sequence from region 301-419. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Solute carrier family 12 member 7; Electroneutral potassium-chloride cotransporter 4; K-Cl cotransporter 4; SLC12A7 KCC4

UniProt

Q9Y666

Expression Region

301-419

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

DPPDIPVCLLGNRTLSRRSFDACVKAYGIHNNSATSALWGLFCNGSQPSAACDEYFIQNNVTEIQGIPGAASGVFLENLWSTYAHAGAFVEKKGVPSVPVAEESRASALPYVLTDIAAS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Sodalis glossinidius Chaperone protein htpG (htpG), partial
MBS1410820 Inquire

Recombinant Sodalis glossinidius Chaperone protein htpG (htpG), partial

Sign In for Pricing
View Details
DEFB108B siRNA (Human)
orb1851661-01 15 nmol

DEFB108B siRNA (Human)

Sign In for Pricing
View Details
DEFB108B siRNA (Human)
orb1851661-02 30 nmol

DEFB108B siRNA (Human)

Sign In for Pricing
View Details
Rabbit Polyclonal AARSD1 Antibody [DyLight 650]
NBP3-00270C 0.1 mL

Rabbit Polyclonal AARSD1 Antibody [DyLight 650]

Sign In for Pricing
View Details
Recombinant Conus marmoreus Chi-conotoxin MrIB
MBS1228502-01 0.05 mg (E-Coli)

Recombinant Conus marmoreus Chi-conotoxin MrIB

Sign In for Pricing
View Details
Recombinant Conus marmoreus Chi-conotoxin MrIB
MBS1228502-02 0.2 mg (E-Coli)

Recombinant Conus marmoreus Chi-conotoxin MrIB

Sign In for Pricing
View Details