Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Small ribosomal subunit protein mS40 (RT18B)

This Recombinant Human Small ribosomal subunit protein mS40 (RT18B) spans the amino acid sequence from region 36-258. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Small ribosomal subunit protein mS40; 28S ribosomal protein S18-2, mitochondrial; MRP-S18-2; 28S ribosomal protein S18b, mitochondrial; MRP-S18-b; Mrps18-b; S18mt-b; Small ribosomal subunit protein bS18b; MRPS18B C6orf14 HSPC183 PTD017

UniProt

Q9Y676

Expression Region

36-258

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

APSEEDSLSSVPISPYKDEPWKYLESEEYQERYGSRPVWADYRRNHKGGVPPQRTRKTCIRRNKVVGNPCPICRDHKLHVDFRNVKLLEQFVCAHTGIIFYAPYTGVCVKQHKRLTQAIQKARDHGLLIYHIPQVEPRDLDFSTSHGAVSATPPAPTLVSGDPWYPWYNWKQPPERELSRLRRLYQGHLQEESGPPPESMPKMPPRTPAEASSTGQTGPQSAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Magic™ Membrane Protein Human TLCD2 (TLC domain containing 2) Expressed in vitro E.coli expression system, Full Length
MPX2656K Each

Magic™ Membrane Protein Human TLCD2 (TLC domain containing 2) Expressed in vitro E.coli expression system, Full Length

Sign In for Pricing
View Details
Hsa-miR-302d-3p miRNA Antagomir
CIJ0161-01 10 nmol

Hsa-miR-302d-3p miRNA Antagomir

Sign In for Pricing
View Details
Hsa-miR-302d-3p miRNA Antagomir
CIJ0161-02 20 nmol

Hsa-miR-302d-3p miRNA Antagomir

Sign In for Pricing
View Details
Cyclin D2 mouse mAb
UB-GEN-15985 100 µL

Cyclin D2 mouse mAb

Sign In for Pricing
View Details
c-erbB2, phosphospecific (HER-2, neu Receptor) (BSA & Azide Free)
MBS6268072-01 0.1 mL

c-erbB2, phosphospecific (HER-2, neu Receptor) (BSA & Azide Free)

Sign In for Pricing
View Details
c-erbB2, phosphospecific (HER-2, neu Receptor) (BSA & Azide Free)
MBS6268072-02 5x 0.1 mL

c-erbB2, phosphospecific (HER-2, neu Receptor) (BSA & Azide Free)

Sign In for Pricing
View Details