Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Selenoprotein K (SELK), partial

This Recombinant Human Selenoprotein K (SELK), partial spans the amino acid sequence from region 43-94. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Selenoprotein K; SelK; SELENOK SELK HSPC030 HSPC297

UniProt

Q9Y6D0

Expression Region

43-94

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QQDVKKRRSYGNSSDSRYDDGRGPPGNPPRRMGRINHLRGPSPPPMAGGUGR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sarcomeric Actinin Alpha 2 / ACTN2 (ACTN2/3294), CF740 conjugate, 0.1mg/mL
BNC743294-100 1x 100 µL

Sarcomeric Actinin Alpha 2 / ACTN2 (ACTN2/3294), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human PGM2L1 activation kit by CRISPRa
GA116997 1 Kit

Human PGM2L1 activation kit by CRISPRa

Sign In for Pricing
View Details
COL27A1 Human Gene Knockout Kit (CRISPR)
KN214474 1 Kit

COL27A1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human IgM (Immunoglobulin Mu Heavy Chain) (B-Cell Marker) (IGHM/2557R), CF488A conjugate, 0.1mg/mL
BNC882557-100 1x 100 µL

Human IgM (Immunoglobulin Mu Heavy Chain) (B-Cell Marker) (IGHM/2557R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant RANBP3 Antibody
RC-16455-01 50 μL

Recombinant RANBP3 Antibody

Sign In for Pricing
View Details
Recombinant RANBP3 Antibody
RC-16455-02 100 µL

Recombinant RANBP3 Antibody

Sign In for Pricing
View Details