Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Selenoprotein K (SELK), partial

This Recombinant Human Selenoprotein K (SELK), partial spans the amino acid sequence from region 43-94. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Selenoprotein K; SelK; SELENOK SELK HSPC030 HSPC297

UniProt

Q9Y6D0

Expression Region

43-94

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QQDVKKRRSYGNSSDSRYDDGRGPPGNPPRRMGRINHLRGPSPPPMAGGUGR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

STX7 Antibody
KC-2067-01 50 μL

STX7 Antibody

Sign In for Pricing
View Details
STX7 Antibody
KC-2067-02 100 µL

STX7 Antibody

Sign In for Pricing
View Details
STX7 Antibody
KC-2067-03 1 mL

STX7 Antibody

Sign In for Pricing
View Details
P55CDC Antibody
8C12167-AAT 50 µg

P55CDC Antibody

Sign In for Pricing
View Details
Veraguensin
TRC-V122300-2.5MG 2.5 mg

Veraguensin

Sign In for Pricing
View Details
Frozen Tissue Sections, Lung
CS504196 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details