Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Selenoprotein K (SELK), partial

This Recombinant Human Selenoprotein K (SELK), partial spans the amino acid sequence from region 43-94. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Selenoprotein K; SelK; SELENOK SELK HSPC030 HSPC297

UniProt

Q9Y6D0

Expression Region

43-94

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QQDVKKRRSYGNSSDSRYDDGRGPPGNPPRRMGRINHLRGPSPPPMAGGUGR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ROD1/PTBP3 Rabbit Polyclonal Antibody
orb312949-01 50 μL

ROD1/PTBP3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ROD1/PTBP3 Rabbit Polyclonal Antibody
orb312949-02 100 µL

ROD1/PTBP3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ROD1/PTBP3 Rabbit Polyclonal Antibody
orb312949-03 200 µL

ROD1/PTBP3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ERCC5 3'UTR Luciferase Stable Cell Line
TU007004 1.0 mL

ERCC5 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Recombinant HAdV-12 E1B Protein (aa 1-163)
VAng-Cr4207-1mgEcoli 1 mg (E. coli)

Recombinant HAdV-12 E1B Protein (aa 1-163)

Sign In for Pricing
View Details
CD106 Fragment, Recombinant, Human, aa109-331, His-Tag (Vascular Cell Adhesion Molecule-1, VCAM-1, INCAM-110) discontinued
C2447-11A 10 µg

CD106 Fragment, Recombinant, Human, aa109-331, His-Tag (Vascular Cell Adhesion Molecule-1, VCAM-1, INCAM-110) discontinued

Sign In for Pricing
View Details