Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein Wnt-6 (WNT6)

This Recombinant Human Protein Wnt-6 (WNT6) spans the amino acid sequence from region 25-365. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Protein Wnt-6 WNT6

UniProt

Q9Y6F9

Expression Region

25-365

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

LWWAVGSPLVMDPTSICRKARRLAGRQAELCQAEPEVVAELARGARLGVRECQFQFRFRRWNCSSHSKAFGRILQQDIRETAFVFAITAAGASHAVTQACSMGELLQCGCQAPRGRAPPRPSGLPGTPGPPGPAGSPEGSAAWEWGGCGDDVDFGDEKSRLFMDARHKRGRGDIRALVQLHNNEAGRLAVRSHTRTECKCHGLSGSCALRTCWQKLPPFREVGARLLERFHGASRVMGTNDGKALLPAVRTLKPPGRADLLYAADSPDFCAPNRRTGSPGTRGRACNSSAPDLSGCDLLCCGRGHRQESVQLEENCLCRFHWCCVVQCHRCRVRKELSLCL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human GFRA1/GDNFRA Protein (Fc Tag)
PKSH032481-01 10 µg

Recombinant Human GFRA1/GDNFRA Protein (Fc Tag)

Sign In for Pricing
View Details
Recombinant Human GFRA1/GDNFRA Protein (Fc Tag)
PKSH032481-02 50 µg

Recombinant Human GFRA1/GDNFRA Protein (Fc Tag)

Sign In for Pricing
View Details
AGXT Polyclonal Antibody
E-AB-66171-01 60 µL

AGXT Polyclonal Antibody

Sign In for Pricing
View Details
AGXT Polyclonal Antibody
E-AB-66171-02 120 µL

AGXT Polyclonal Antibody

Sign In for Pricing
View Details
AGXT Polyclonal Antibody
E-AB-66171-03 200 µL

AGXT Polyclonal Antibody

Sign In for Pricing
View Details
1700001C19Rik Mouse Gene Knockout Kit (CRISPR)
KN500052 1 Kit

1700001C19Rik Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details