Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Choline/ethanolaminephosphotransferase 1 (CEPT1), partial

This Recombinant Human Choline/ethanolaminephosphotransferase 1 (CEPT1), partial spans the amino acid sequence from region 1-88. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Choline/ethanolaminephosphotransferase 1; hCEPT1; EC 2.7.8.1; EC 2.7.8.2; 1-alkenyl-2-acylglycerol choline phosphotransferase; EC 2.7.8.22; CEPT1 PRO1101

UniProt

Q9Y6K0

Expression Region

1-88

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research; Pharmacology & Drug Discovery

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MSGHRSTRKRCGDSHPESPVGFGHMSTTGCVLNKLFQLPTPPLSRHQLKRLEEHRYQSAGRSLLEPLMQGYWEWLVRRVPSWIAPNLI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Transmembrane protein 80 (TMEM80) Bovine ELISA Kit
H8615 96 Tests

Transmembrane protein 80 (TMEM80) Bovine ELISA Kit

Sign In for Pricing
View Details
RIPK1 Rabbit Polyclonal Antibody (APC-Cy7)
orb2436819 100 µL

RIPK1 Rabbit Polyclonal Antibody (APC-Cy7)

Sign In for Pricing
View Details
CLASP2 Rabbit Polyclonal Antibody
TA374832 100 µL

CLASP2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
NDEL1 CRISPR/Cas9 KO Plasmid (m)
sc-429902 20 µg

NDEL1 CRISPR/Cas9 KO Plasmid (m)

Sign In for Pricing
View Details
DDX1 Rabbit Polyclonal Antibody (APC)
orb1003762 100 µL

DDX1 Rabbit Polyclonal Antibody (APC)

Sign In for Pricing
View Details
FTS (AKTIP) (NM_001012398) Human Over-expression Lysate
LC422846 20 µg

FTS (AKTIP) (NM_001012398) Human Over-expression Lysate

Sign In for Pricing
View Details