Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein piccolo (PCLO), partial

This Recombinant Human Protein piccolo (PCLO), partial spans the amino acid sequence from region 4694-4823. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Protein piccolo; Aczonin; PCLO ACZ KIAA0559

UniProt

Q9Y6V0

Expression Region

4694-4823

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

ITGEIQLQINYDLGNLIIHILQARNLVPRDNNGYSDPFVKVYLLPGRGQVMVVQNASAEYKRRTKHVQKSLNPEWNQTVIYKSISMEQLKKKTLEVTVWDYDRFSSNDFLGEVLIDLSSTSHLDNTPRWY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TGFalpha (TGFA/1119), CF488A conjugate, 0.1mg/mL
BNC881119-500 1x 500 µL

TGFalpha (TGFA/1119), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Denatonium Benzoate
TRC-D231660-250MG 250 mg

Denatonium Benzoate

Sign In for Pricing
View Details
NF-kappaB p105/p50 Rabbit Polyclonal Antibody
R1309-9 100 µL

NF-kappaB p105/p50 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
IRF5 (NM_001098627) Human Over-expression Lysate
LY420650 100 µg

IRF5 (NM_001098627) Human Over-expression Lysate

Sign In for Pricing
View Details
SC35 (SRSF2) (NM_003016) Human Over-expression Lysate
LY418954 100 µg

SC35 (SRSF2) (NM_003016) Human Over-expression Lysate

Sign In for Pricing
View Details
CD68 (KP1), CF405S conjugate, 0.1mg/mL
BNC040512-100 1x 100 µL

CD68 (KP1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details