Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 27 (TVA27)

This Recombinant Human T cell receptor alpha variable 27 (TVA27) spans the amino acid sequence from region 20-109. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 27 TRAV27

UniProt

A0A087WT01

Expression Region

20-109

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QLLEQSPQFLSIQEGENLTVYCNSSSVFSSLQWYRQEPGEGPVLLVTVVTGGEVKKLKRLTFQFGDARKDSSLHITAAQTGDTGLYLCAG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ML254 1mg
A22242-1 1 mg

ML254 1mg

Sign In for Pricing
View Details
SLC34A1 Rabbit Polyclonal Antibody (FITC)
orb463033 100 µL

SLC34A1 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
HTRA3 (HtrA Serine Peptidase 3, Prsp, Tasp) (Biotin)
247336-Biotin 100 µL

HTRA3 (HtrA Serine Peptidase 3, Prsp, Tasp) (Biotin)

Sign In for Pricing
View Details
4- (4-Acetylpiperazin-1-yl) benzoic acid
OR2498-01 100 mg

4- (4-Acetylpiperazin-1-yl) benzoic acid

Sign In for Pricing
View Details
4- (4-Acetylpiperazin-1-yl) benzoic acid
OR2498-02 250 mg

4- (4-Acetylpiperazin-1-yl) benzoic acid

Sign In for Pricing
View Details
4- (4-Acetylpiperazin-1-yl) benzoic acid
OR2498-03 500 mg

4- (4-Acetylpiperazin-1-yl) benzoic acid

Sign In for Pricing
View Details