Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Small integral membrane protein 26 (SIM26), partial

This Recombinant Human Small integral membrane protein 26 (SIM26), partial spans the amino acid sequence from region 36-95. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Small integral membrane protein 26 SMIM26 LINC00493

UniProt

A0A096LP01

Expression Region

36-95

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

AKSSVDQKDGSASEVPSELSERPKGFYVETVVTYKEDFVPNTEKILNYWKSWTGGPGTEP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KRTAP5-5 siRNA (Human)
CRJ8222-01 15 nmol

KRTAP5-5 siRNA (Human)

Sign In for Pricing
View Details
KRTAP5-5 siRNA (Human)
CRJ8222-02 30 nmol

KRTAP5-5 siRNA (Human)

Sign In for Pricing
View Details
GSK-7975A 50mg
A16931-50 50 mg

GSK-7975A 50mg

Sign In for Pricing
View Details
c-erbB2 (HER-2, neu Receptor) (BSA & Azide Free) (HRP)
MBS6266720-01 0.1 mL

c-erbB2 (HER-2, neu Receptor) (BSA & Azide Free) (HRP)

Sign In for Pricing
View Details
c-erbB2 (HER-2, neu Receptor) (BSA & Azide Free) (HRP)
MBS6266720-02 5x 0.1 mL

c-erbB2 (HER-2, neu Receptor) (BSA & Azide Free) (HRP)

Sign In for Pricing
View Details
IRF3 Antibody
orb2636626 100 µg

IRF3 Antibody

Sign In for Pricing
View Details