Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 6-5 (TVB65)

This Recombinant Human T cell receptor beta variable 6-5 (TVB65) spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 6-5 TRBV6-5

UniProt

A0A0K0K1A5

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVTQTPKFQVLKTGQSMTLQCAQDMNHEYMSWYRQDPGMGLRLIHYSVGAGITDQGEVPNGYNVSRSTTEDFPLRLLSAAPSQTSVYFCASSY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Hu CD3 APC
1A-631-T100 100 Tests

Anti-Hu CD3 APC

Sign In for Pricing
View Details
Guanylyl Cyclase alpha 1 Recombinant Antibody, APC-Cy5.5 Conjugated
bsm-62410R-APC-Cy5.5 100 µL

Guanylyl Cyclase alpha 1 Recombinant Antibody, APC-Cy5.5 Conjugated

Sign In for Pricing
View Details
Mouse SUN domain-containing protein 1 (SUN1) ELISA Kit
abx547957 96 Tests

Mouse SUN domain-containing protein 1 (SUN1) ELISA Kit

Sign In for Pricing
View Details
Mouse AQP2 ELISA Kit
E044705 1 Each

Mouse AQP2 ELISA Kit

Sign In for Pricing
View Details
Human SLC26A6 (NM_022911) AAV Particle
RC204394A1V 250 µL

Human SLC26A6 (NM_022911) AAV Particle

Sign In for Pricing
View Details
BENZOYL BROMIDE
902004 each

BENZOYL BROMIDE

Sign In for Pricing
View Details