Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 6-5 (TVB65)

This Recombinant Human T cell receptor beta variable 6-5 (TVB65) spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 6-5 TRBV6-5

UniProt

A0A0K0K1A5

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVTQTPKFQVLKTGQSMTLQCAQDMNHEYMSWYRQDPGMGLRLIHYSVGAGITDQGEVPNGYNVSRSTTEDFPLRLLSAAPSQTSVYFCASSY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal LSM5 Antibody (25F8) [mFluor Violet 610 SE]
NBP2-59399MFV610 0.1 mL

Mouse Monoclonal LSM5 Antibody (25F8) [mFluor Violet 610 SE]

Sign In for Pricing
View Details
pCMV-SPORT6-Napb Plasmid
PVT58010 2 µg

pCMV-SPORT6-Napb Plasmid

Sign In for Pricing
View Details
TCEAL5 CRISPR Activation Plasmid (h2)
sc-415545-ACT-2 20 µg

TCEAL5 CRISPR Activation Plasmid (h2)

Sign In for Pricing
View Details
SGK3 Lentiviral Activation Particles (m)
sc-431309-LAC 200 µL

SGK3 Lentiviral Activation Particles (m)

Sign In for Pricing
View Details
Inhibitor hsa-miR-5189-5p AAV miRNA Vector
Amh3188400 500 ng

Inhibitor hsa-miR-5189-5p AAV miRNA Vector

Sign In for Pricing
View Details
GUCY1B1 Rabbit Polyclonal Antibody (FITC)
orb2096403 100 µL

GUCY1B1 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details