Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Transcriptional regulator SEHBP (SEHBP)

This Recombinant Human Transcriptional regulator SEHBP (SEHBP) spans the amino acid sequence from region 1-46. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Transcriptional regulator SEHBP; Short ORF-encoded histone-binding protein; ZNF689 upstream open reading frame protein; ZNF689

UniProt

C0HLU2

Expression Region

1-46

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MALRSIKSIAGSCLCSRQRRCGSSAAIFPEGIFRCLSPKFGQEFPE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NELL2 (NM_001145107) Human Over-expression Lysate
LY428694 100 µg

NELL2 (NM_001145107) Human Over-expression Lysate

Sign In for Pricing
View Details
hIgG Kappa light chain Specific Rabbit monoclonal antibody, OTIR1G7
TA592621 100 µL

hIgG Kappa light chain Specific Rabbit monoclonal antibody, OTIR1G7

Sign In for Pricing
View Details
Uncoated Human ADAM10 (A Disintegrin And Metalloprotease 10) ELISA Kit
E-UNEL-H0204-01 5x 96 Tests

Uncoated Human ADAM10 (A Disintegrin And Metalloprotease 10) ELISA Kit

Sign In for Pricing
View Details
Uncoated Human ADAM10 (A Disintegrin And Metalloprotease 10) ELISA Kit
E-UNEL-H0204-02 15x 96 Tests

Uncoated Human ADAM10 (A Disintegrin And Metalloprotease 10) ELISA Kit

Sign In for Pricing
View Details
TPIP1 Antibody
8C13126-AAT 50 µg

TPIP1 Antibody

Sign In for Pricing
View Details
Zfp62 Mouse Gene Knockout Kit (CRISPR)
KN519911 1 Kit

Zfp62 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details